SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|237653640|ref|YP_002889954.1| from Thauera sp. MZ1T

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|237653640|ref|YP_002889954.1|
Domain Number 1 Region: 37-221
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.53e-26
Family Astacin 0.024
Further Details:      
 
Domain Number 2 Region: 239-340
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000902
Family Collagen-binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|237653640|ref|YP_002889954.1|
Sequence length 344
Comment peptidase domain-containing protein [Thauera sp. MZ1T]
Sequence
MTRTPKVCFDRVLPRDLMRFQTTMPDRPGQVRGLSPIGKTWINGSTLHVRFMGGSAQHKK
KVQEQAAWWTAHANLQFVFDDAPAAEIRITFDENDGAWSYIGTDAKSIPVNEPTMNLGFL
DGGTAAHEFGHAIGLAHEHQNPAGGIQWNEQAVIRAMAGPPNHWSETQTRHNILRKYAAN
QVNGTDFDPKSVMLYFFPAEWTLNGVATSRNEVLSELDKQFIAGAKMYPRAKPGVTGEVT
ELKVNARRRTAASIGKFGEEDVFRFRVTQPGRYVVDTRGPTDVYMKLFGPDSPTALIAED
DDSGLGSNARIATDLVEGEYFVQVRHWNRASGVGDYTVAVRTAN
Download sequence
Identical sequences C4KB01 N6YXQ1
WP_004303202.1.58410 WP_004303202.1.88725 85643.Tmz1t_2978 gi|237653640|ref|YP_002889954.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]