SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|434391184|ref|YP_007126131.1| from Gloeocapsa sp. PCC 7428

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434391184|ref|YP_007126131.1|
Domain Number 1 Region: 4-147
Classification Level Classification E-value
Superfamily CheY-like 9.68e-38
Family CheY-related 0.00095
Further Details:      
 
Domain Number 2 Region: 172-376
Classification Level Classification E-value
Superfamily PP2C-like 0.000000366
Family PP2C-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|434391184|ref|YP_007126131.1|
Sequence length 377
Comment response regulator receiver modulated serine phosphatase [Gloeocapsa sp. PCC 7428]
Sequence
MSLILVIDDDPTVQTMLSRVLKSQGYQVVVTHNGEEGIRLARQLYPGLVICEWTMQSMSG
LEVCRRIKAEPRLSTVFFIFLTSLGSVSDCVQAFDAGGDDFITKPIEQNELTARVRAGLR
LHQMSRDLQKQKQLLEAELSEAADYVRSLLPPQLKEPLEINSRFIPSLRLGGDCFDYYWL
DPDYLAIYLLDTAGHGLGATLPSISVLNMLRSRALDGINYYQPTDVLRALNSTFQMTSQN
SKYFTIWYGVYNRVNRQLIYSNAGHPPAVLLSEKPTLHVTKLETPSIPIGMFPDTNYTDK
FFQIPESSTLYIFSDGVYELHLADGSIWELDSFIELLKTDHIVGNCDLDTILAQLNQINY
KESFDDDLSILQIRFDN
Download sequence
Identical sequences K9XA73
WP_015186848.1.9315 gi|434391184|ref|YP_007126131.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]