SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|434391248|ref|YP_007126195.1| from Gloeocapsa sp. PCC 7428

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434391248|ref|YP_007126195.1|
Domain Number 1 Region: 2-147
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 7.72e-37
Family N-terminal domain of MutM-like DNA repair proteins 0.00073
Further Details:      
 
Domain Number 2 Region: 141-231
Classification Level Classification E-value
Superfamily S13-like H2TH domain 8.98e-28
Family Middle domain of MutM-like DNA repair proteins 0.0013
Further Details:      
 
Domain Number 3 Region: 231-281
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.3e-16
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|434391248|ref|YP_007126195.1|
Sequence length 282
Comment DNA-(apurinic or apyrimidinic site) lyase [Gloeocapsa sp. PCC 7428]
Sequence
MPELPEVETVRRGLNQVTLSQQIMGGDVLLERTIAHPLSIAEFLTGIQGCAIAQWHRYGK
YLLAETQHSSNTASGWLGVHLRMTGQLLWLNQDEELHKHTRVRLFFDNKLELRFVDQRTF
GQMWWVPPEIPVESVITGLAKLGLDPFSPAFSVDYLTQKFKNRQRAIKTALLDQAMVAGL
GNIYADEALFLSQLRPTTLCSELRLPQIEKLRRSIIQVLETSIAAGGTTFSTFLNVQGVN
GKYSGIAWVYNRTGQPCRICQTPIQRIRLAGRSSHFCPNCQQ
Download sequence
Identical sequences K9X8S2
gi|434391248|ref|YP_007126195.1| WP_015186912.1.9315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]