SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|434391565|ref|YP_007126512.1| from Gloeocapsa sp. PCC 7428

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434391565|ref|YP_007126512.1|
Domain Number 1 Region: 63-354
Classification Level Classification E-value
Superfamily Pectin lyase-like 2.1e-41
Family Pectin methylesterase 0.076
Further Details:      
 
Weak hits

Sequence:  gi|434391565|ref|YP_007126512.1|
Domain Number - Region: 540-572
Classification Level Classification E-value
Superfamily Sporulation related repeat 0.0157
Family Sporulation related repeat 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|434391565|ref|YP_007126512.1|
Sequence length 575
Comment parallel beta-helix repeat protein [Gloeocapsa sp. PCC 7428]
Sequence
MNLTRPDTYFDLAPFILSITKISHPSSYAIALGLSSIALLGLSDTGLTSEALPLYLKDAR
ANQIASAKVLFVNPNVENAAQANGSDRAPFKTITQALKVASVNSVIMLAKGTYSAETGET
FPLQLKSGVAIQGDPQTRGSGVIIQGGGVFLSPTFAQQNVTILGANQATLTGVTITNSNP
RGYGLWIESSSPRITDNTFTGSAHDGISVTGDSKPLIRNNYFHQNGANGITIYGISRPEV
RENIFEKTGFGINVSQKAAPLLIGNRITQNRAGIVVQAQAQPVLRSNTIEGNIEDGVVAI
AASLPDLGTSAQPGGNIFRQNGRYDINSKAARQTISAFGNTLAADARTVGNLDLSGKVLA
AIPQAVPANIATKPPTVAPVRSTTPTNTMARSVAPEAIAIPVPPANTNNSRARSLPSPPA
TGSDTAIVIPVPPPTTSATIVPPPSNPNPGAINVPVLQSAQITEADLLPVPSGNIPLGNA
RNLPKINLPTTAPAPGTPPLPPTRESALGLRYRVIVEAESKSKQDMVRSIVPGAFRTFSN
GKVFMQVGAFGDRVNANEVLQLLNNRGLKGTVEQI
Download sequence
Identical sequences K9XCI4
gi|434391565|ref|YP_007126512.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]