SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|434391707|ref|YP_007126654.1| from Gloeocapsa sp. PCC 7428

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434391707|ref|YP_007126654.1|
Domain Number 1 Region: 173-489
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 8.16e-116
Family Leucine aminopeptidase, C-terminal domain 0.000000509
Further Details:      
 
Domain Number 2 Region: 1-176
Classification Level Classification E-value
Superfamily Macro domain-like 5.89e-38
Family Leucine aminopeptidase (Aminopeptidase A), N-terminal domain 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|434391707|ref|YP_007126654.1|
Sequence length 491
Comment leucyl aminopeptidase [Gloeocapsa sp. PCC 7428]
Sequence
MEIRAIDTPLLDWTGDCLAIGLFEEAEELQGDVAQLNDKFAGALKEIIEETEFKGKEGSS
AVTRIGGASPVRKVFLIGLGNQETLRLDSLRRAGATVARLAKKEKCKTVGVNLPTVDNDP
AATVQAIAEGLQLASYQDNRFKSEPEEKVLVERVDLLGFAGQEAAIARANSICSGVNLAR
ELVAAPPNEVTPITLAETAQKIAEDHGLQVEILEREECEKLGMGAFLGVAQASDLPPKFI
HLTYKPEGTPKRRLAIIGKGLTFDSGGLNIKAGAGSSIEMMKMDMGGAGATLGAAKAIAQ
LKPDVEVHFISAATENMISGRAMHPGDILKASNGKTIEVNNTDAEGRLTLADALVFAEKL
GVDAIVDLATLTGACIIALGDEIAGLFSPDDELAQQLAQAAEAAGEKLWRMPFEEKYFEG
LKSGIADFKNTGPRGGGSITAALFLKQFVKETPWAHLDIAGPVWTDKENGCSNPGATGYG
VRTLVHWVLSN
Download sequence
Identical sequences K9XBN2
gi|434391707|ref|YP_007126654.1| WP_015187371.1.9315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]