SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|434391971|ref|YP_007126918.1| from Gloeocapsa sp. PCC 7428

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434391971|ref|YP_007126918.1|
Domain Number 1 Region: 19-311,352-375
Classification Level Classification E-value
Superfamily Pectin lyase-like 5.02e-33
Family Filamentous hemagglutinin FhaB, secretion domain 0.0047
Further Details:      
 
Domain Number 2 Region: 418-543,571-598
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000000439
Family Filamentous hemagglutinin FhaB, secretion domain 0.077
Further Details:      
 
Domain Number 3 Region: 599-646,679-705
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000314
Family Filamentous hemagglutinin FhaB, secretion domain 0.072
Further Details:      
 
Weak hits

Sequence:  gi|434391971|ref|YP_007126918.1|
Domain Number - Region: 703-791
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00185
Family Filamentous hemagglutinin FhaB, secretion domain 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|434391971|ref|YP_007126918.1|
Sequence length 930
Comment filamentous hemagglutinin family outer membrane protein [Gloeocapsa sp. PCC 7428]
Sequence
MKQSINLFWISGSFVFSIFSQSVQAQIIPDGTTPTTSELCTAVCEIIGGTQTGENLFHSF
SQFNINSDQQVTFSDPGVTNIITRVTGGNPSNILGTLDVAGDANLFLINPNGIIFGSTAF
VNVSGSFVATTADAIQFSNQGSFNVNPANSPDLLTVNPSALLFNQITAQSPPSIELNDGL
IFLPDAQSLVLLGGNINIAGDFNIEHLIAPSGRIELGGVLGAGIVGLNNVNGKNLSLSFP
ANIARGDVSISNGVIASVAGDGSGSIAINARNINIAQSNIIAGVSPDFEATNNQLGTINL
DATEGIEITRATLTNEVQLEAVGNAGDIQIKAGSLLLNEFSNINSTVNPRASGNAGNVLI
QANDVAIANDASINTLMLGSGEGDGGDIQIDADSLLLENGSLNARAIAPGSVAGNVSINA
NNVSLLGDRSLIGTAALVSASRGGAVNIQANAVSLSNGATLFSSTTEEAGRAGNINITAN
TVSLADSAIYNDTIGLGDAGDTQINARTLNISNGGSISTSTNGAGNAGSIFINASEFVTL
SGTNPNAITIIRNIPSTTSSGLFAFTDTNATGRGGNIQVNTGNLSILDGAVISARTRGIA
PGGNITVNATNVAATNGGQILTSAFNQGMAGNITVNATNSVSISGSDRTYNDRLQQTPDR
IDNDGAASGFLARVRGDAIADAGQINVTAPSISLDNQGTISTATTQGAGGQISLRGRNVA
LNDNSSITATAGTANAGGNGGNIDISSELFFATRNSAVTANAFTGNGGNIRIATQGFFLS
PDSVITASSAQGIDGVVEIIVVDDEPSRGLVSLPEQPVDVSNLVARGCTADTNIATNTSE
FIITGRGGLPPTPGEAINANSVLADLGTPVQTQAATPLNTVSNLNNSQPKSLVEAQGWMV
GSNGEVVLMAQVPTATTYTSWSTPVACNAP
Download sequence
Identical sequences K9XB81
WP_015187634.1.9315 gi|434391971|ref|YP_007126918.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]