SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|434391978|ref|YP_007126925.1| from Gloeocapsa sp. PCC 7428

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434391978|ref|YP_007126925.1|
Domain Number 1 Region: 5-378
Classification Level Classification E-value
Superfamily Citrate synthase 3.66e-138
Family Citrate synthase 0.0000000362
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|434391978|ref|YP_007126925.1|
Sequence length 378
Comment citrate synthase [Gloeocapsa sp. PCC 7428]
Sequence
MSVCEFKPGLEGIPAAQSSISFVNGQEGILEYRGIRIEDLADNSTFLETAYLLIWGKLPT
KDELIEFEHEVRYHRRIKYRIRDMMKSFPESGHPMDALQASAAALGLFYSRRDLDNPVYI
RDAVVRLLATIPTMVAAFQLMRKGNDPVRPRDDLDYSANFLYMLSEREPDPLMARIFDVC
LTLHAEHTMNASTFSARVTASTLTDPYAVVASAVGTLGGPLHGGANEEVIGMLEEIGSVE
NVRPYLEDRLQRKAKIMGFGHRVYKVKDPRATILQKLAEQMFDKFGYDKYYDIAVELERA
IAEKLGHKGIYPNVDFYSGLVYRKMGIPTDLFTPVFAIARVAGWLAHWKEQIAENRIFRP
TQVYTGDHDVSYTPIEQR
Download sequence
Identical sequences K9XAS6
gi|434391978|ref|YP_007126925.1| WP_015187641.1.9315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]