SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|434392062|ref|YP_007127009.1| from Gloeocapsa sp. PCC 7428

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434392062|ref|YP_007127009.1|
Domain Number 1 Region: 3-223,336-409
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.91e-77
Family Bacterial dinuclear zinc exopeptidases 0.00025
Further Details:      
 
Domain Number 2 Region: 213-329
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 1.14e-27
Family Bacterial exopeptidase dimerisation domain 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|434392062|ref|YP_007127009.1|
Sequence length 412
Comment amidase, hydantoinase/carbamoylase family [Gloeocapsa sp. PCC 7428]
Sequence
MTVALIPVVNGDRLNRNISQLAEIGKLPGGGVSRVAFTAEDILARQLVQSWMIEAGMTVQ
IDAAGNIIGTYAGRQENAGALATGSHIDTVPVAGKFDGVLGVLAGIEVVHVLQENNIRLR
HPIEVIVFTDEENSVLGCKAMAGTAVLDPGCYRRNDGTPIEACLARIGGDWSQLATAKRQ
PGEIAAFVELHVEQGGVLESTGDDVGVVIGIVGQYRHHVTVTGRPNHAGTTPMNMRKDAL
VAASQIVLAVNKLATETPGEQVATVGYFSVSPNAANIVPARVDLKIDLRDMSQTHLEDMV
AQIKNQLVDIAAATQTEIEMTQMLHVLPTLAAPDIQAAIAQICQHLGLSYTYLPSRAGHD
AQEIGRFADMGMIFVPSRAGISHAEDEYTSPEHCTQGANVLLQTFLKLDEIY
Download sequence
Identical sequences K9XCN3
WP_015187725.1.9315 gi|434392062|ref|YP_007127009.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]