SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|434392144|ref|YP_007127091.1| from Gloeocapsa sp. PCC 7428

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434392144|ref|YP_007127091.1|
Domain Number 1 Region: 2-115
Classification Level Classification E-value
Superfamily PIN domain-like 1.85e-16
Family PIN domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|434392144|ref|YP_007127091.1|
Sequence length 128
Comment PilT-like protein [Gloeocapsa sp. PCC 7428]
Sequence
MAVDTNIVVRLLIQDDQQQYDKSLQIFQEQDIFVPDTVLLETEWVLRFAYNFKPSEICQA
FRNLLGLPNIHLTNATLIAQALQWYENGLDFADALHLSQSQSCSVLYTFDAKFANRAKGL
TQCKVQQP
Download sequence
Identical sequences K9XCY2
gi|434392144|ref|YP_007127091.1| WP_015187807.1.9315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]