SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|434392147|ref|YP_007127094.1| from Gloeocapsa sp. PCC 7428

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434392147|ref|YP_007127094.1|
Domain Number 1 Region: 188-353
Classification Level Classification E-value
Superfamily HI0933 insert domain-like 7.46e-43
Family HI0933 insert domain-like 0.00054
Further Details:      
 
Domain Number 2 Region: 5-188,350-407
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.56e-42
Family HI0933 N-terminal domain-like 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|434392147|ref|YP_007127094.1|
Sequence length 410
Comment HI0933 family protein [Gloeocapsa sp. PCC 7428]
Sequence
MQPLIVVIGGGAAGFFGAIAAAQAHPHTQVIILEASHQPLAKVRVSGGGRCNVTHACFEP
TALVQNYPRGGKALRGAFTRFQSRDTVNWFAAQGVKLKTEPDGRMFPLTDDSATIVDCLR
EKAIALGIKIRIGAAVVAVKALDGTTSRFAIQLKSKEVITCDRVLLATGSNKVGHQIAAS
LGHHIESPVPSLFTFNILDQDLRELAGVSVDSVRLKLTVGSHKLEQTGPLLITHWGLSGP
AVLKLSAWGARVLYDAKYHATLTINWLPQCNPEDIRQKLLAVKTEWAKRAIASNCPVELP
RRLWQYLVSRINLGSEDRWSGISHKSLNRLVQELTQGQYLIQGKGVFKEEFVTCGGVSLK
EVNFKTMESRLCQGLYFAGEILDIDGVTGGFNFQSAWTTAWLAGQAMGVV
Download sequence
Identical sequences K9XCX1
WP_015187810.1.9315 gi|434392147|ref|YP_007127094.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]