SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|434392153|ref|YP_007127100.1| from Gloeocapsa sp. PCC 7428

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434392153|ref|YP_007127100.1|
Domain Number 1 Region: 7-329
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.14e-118
Family TK-like PP module 0.00000000204
Further Details:      
 
Domain Number 2 Region: 341-539
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.87e-66
Family TK-like Pyr module 0.000000256
Further Details:      
 
Domain Number 3 Region: 544-676
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 6.02e-45
Family Transketolase C-terminal domain-like 0.0000221
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|434392153|ref|YP_007127100.1|
Sequence length 677
Comment transketolase [Gloeocapsa sp. PCC 7428]
Sequence
MAVATQSLEELCINSIRFLAIDAVEKAKSGHPGLPMGAAPMAFVLWDRFMRFNPKNPTWY
NRDRFLLSAGHGSMLLYALLYLTGYEDLTLEDLKQFRQWESKTPGHPENFMNPGVEITTG
PLGQGIANGVGIAMAEAHLAAKFNKPDFPIVDHYTYVILGDGCNMEGVSGEACSLAGHLG
LGKLIALYDDNHISIDGSTDLAFTEDVGKRFEAYGWHVQVVEDGNTDLDAIHKAIEVAQS
VTDKPSLIKVRTTIGYGSPKKANTRHAHGEALGADEVKATREHLGWNHEPFEVPEDALNH
WRQAIDRGAKLEQEWNQLFERYKEQYPEEARLLKRMHEAELPEGWDSVLPTYSPEDKGIA
TRVHSGNCLNAIAEVLPELIGGSADLAPSNNTLLKSSGDFQKGQYENRYIRFGVREHGMG
AICNGLALDGSGLIPYCATFLVFTDYMRAAIRLSALSEAGVIYVMTHDSIALGEDGPTHQ
PIEHVASLRAIPDLYVIRPADGNETSGAYKVAIKAARGKRYGNKTRPSVLALTRQAVPNL
AGSSIEGVTKGAYVLSDSDGTPDLIMIGTGSETQLCVQAAEQLRSEGKKVRVVSMPCWEV
FEEQDAEYRESVLPKAVKKRVSVEAGSTFGWCRYVGDEGIAIGIDQYGSSAPGSVCMEKF
GFTVDNVVAKAKAVLGE
Download sequence
Identical sequences K9XBB2
WP_015187816.1.9315 gi|434392153|ref|YP_007127100.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]