SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|434392415|ref|YP_007127362.1| from Gloeocapsa sp. PCC 7428

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434392415|ref|YP_007127362.1|
Domain Number 1 Region: 39-216
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 2.01e-72
Family HD domain 0.0000014
Further Details:      
 
Domain Number 2 Region: 205-424
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 1.23e-62
Family RelA/SpoT domain 0.0000178
Further Details:      
 
Domain Number 3 Region: 407-479
Classification Level Classification E-value
Superfamily TGS-like 1.35e-22
Family G domain-linked domain 0.036
Further Details:      
 
Domain Number 4 Region: 678-756
Classification Level Classification E-value
Superfamily ACT-like 0.0000000000000229
Family AF1403 N-terminal domain-like 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|434392415|ref|YP_007127362.1|
Sequence length 761
Comment (p)ppGpp synthetase I, SpoT/RelA [Gloeocapsa sp. PCC 7428]
Sequence
MNAAVSTVTHATAPVAFDVELPEWLQKCLVAPQESHQPSEQDNSLICRAFSFAYDLHQGQ
YRKSGEPYICHPVAVAGLLRDLGGSSAMIAAGFLHDVVEDTDVSIEDIEQRFGNEVRQLV
EGVTKLSEFSQKFSSKTERQAENFRRMFLAMAKDIRVIVVKLADRLHNMRTLEHLAPEKQ
RRIALETREIFAPLANRLGIGRFKWELEDLAFKYLEPEAYRQIQDLVAEKRVNREARLTR
VIDVLTARMEQAEIKCIDISGRPKHLYGIYQKMQRQQKEFHEIYDIAAIRIIVNTKEECY
RALAEVHDAFKPIPGRFKDYIGLPKPNRYQSLHTAVVGFTGRPLEVQIRTLEMHHVAEYG
IAAHWKYKETGSSSHSQLKTSEEKFTWLRQILEWQNDLKDVNDAQEYLDSVKDNLFEDDV
YVFTPKGDVVSLTAGATPVDFAYRIHTEVGNHCCGARVNERMVTLDTPLKNGDIVDILTQ
KNSHPSLDWLNFVVTTGAKNRIRQWYKRSHREENIARGRELLEKELGKTGFEALLKSEPM
QAVAEKCNYHSVEDLLAALGYGEITLNLVLNRLREIIKAQQPIAQTADVTVLPSSTKTHK
EPLPSSRSDSPIAGVEGLLYHLAKCCTPIPGEPIIGVVTRNSRGISIHRQGCQNVENIEG
DRLIPVSWNHNNSERSRPQTYTVNIQIEAIDRVGILKDILSRLSDQGINVRNAQVKTSNG
QPALIDLGIDIRDRTQLEQVFAQIKKMSDVINLRRIGQAED
Download sequence
Identical sequences K9XEV0
WP_015188077.1.9315 gi|434392415|ref|YP_007127362.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]