SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|434392821|ref|YP_007127768.1| from Gloeocapsa sp. PCC 7428

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434392821|ref|YP_007127768.1|
Domain Number 1 Region: 72-165
Classification Level Classification E-value
Superfamily MAPEG domain-like 6.93e-18
Family MAPEG domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|434392821|ref|YP_007127768.1|
Sequence length 169
Comment putative relative of glutathione S-transferase MAPEG superfamily [Gloeocapsa sp. PCC 7428]
Sequence
MTNPIPISTLFIGLSGFIAFALSYIVVMERISTRVWHGGSKEEVVTQHNYLDKPSKWAAF
VENYTQKSVATKTSDDGVLQRKVRAFGNFIEYVPLGLLFLVALELMKLPTVLVWLLGSGL
IVGRIAHAWGLITTYGPSPGRAVGFFLTWFVYLVGAGVCVYHGVVGILS
Download sequence
Identical sequences K9XDQ4
gi|434392821|ref|YP_007127768.1| WP_015188481.1.9315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]