SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|434393376|ref|YP_007128323.1| from Gloeocapsa sp. PCC 7428

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434393376|ref|YP_007128323.1|
Domain Number 1 Region: 86-218
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 1.91e-17
Family GntR ligand-binding domain-like 0.024
Further Details:      
 
Domain Number 2 Region: 16-83
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 6.14e-16
Family GntR-like transcriptional regulators 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|434393376|ref|YP_007128323.1|
Sequence length 224
Comment transcriptional regulator, GntR family [Gloeocapsa sp. PCC 7428]
Sequence
MTAKLQFPTITGLSRTTQASVTDYLRKAILSGELPAGTRLVQAELSQVLNVSVTPIREAL
RELSTQGLVDLDAFRGAVVHAPTLAELEEIFEIRRALLPLSIQRGVYAITEQELQQAELL
LAQMEVESDRPRWVELNRQFHDLLYQADRSLHLKTLLQRLSDIAAIYINLSFAERPLQKE
SAEKEHRELLEAYRSKDAARAINISLNHINSTLEAARKVLQSHQ
Download sequence
Identical sequences K9XFA1
WP_015189035.1.9315 gi|434393376|ref|YP_007128323.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]