SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|434393398|ref|YP_007128345.1| from Gloeocapsa sp. PCC 7428

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|434393398|ref|YP_007128345.1|
Domain Number - Region: 80-141
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 0.0691
Family HD domain 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|434393398|ref|YP_007128345.1|
Sequence length 176
Comment hypothetical protein Glo7428_2684 [Gloeocapsa sp. PCC 7428]
Sequence
MRRKQSLSLLLTALGVMCLVVLGSGRHNPTQFAFRQPPAIAQSARISDAWQQVYQQLPDL
PLENQYINRQTGKVDPENTLLRRLISYHTFVKGRPPNYRLDWKLTLADYLGANEWIREES
YPGHDTLRQNPLEGDRAAIQRLNRNQRNALVQALVNVFSSVSQTTPNTPPEAQQNP
Download sequence
Identical sequences K9XEY3
gi|434393398|ref|YP_007128345.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]