SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|434393779|ref|YP_007128726.1| from Gloeocapsa sp. PCC 7428

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434393779|ref|YP_007128726.1|
Domain Number 1 Region: 306-359,408-637
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.09e-30
Family Tandem AAA-ATPase domain 0.048
Further Details:      
 
Domain Number 2 Region: 61-138
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 0.0000799
Family HD domain 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|434393779|ref|YP_007128726.1|
Sequence length 796
Comment CRISPR-associated helicase, Cas3 family [Gloeocapsa sp. PCC 7428]
Sequence
MSKIPEKLLAKSKPQVTLEAHLRDTEKAAELIFRLTGRWGRNWCRFFGIEGEESQKKFLL
NLRIAALFHDIGKANEDFYEAVKALGFKPQTLRHEHLSALVLCLPEVRIWLAQNSSLDID
VVTSAVLSHHLKASESQITIKGDREASQTLKNYRWCQPQSSKTSVVLYFQHGEVLRILNR
IAEVAELGAIPSVPQIDWKPGSLWELAYRQGKQFGTNFKRELGDVKNQPRKSLLVAVKAG
LIVADAAASGLVREGKDIEDWIEEVVHSESITHDDIANAIINPRIEQIKAKTGSFKLATF
QKQIAKQGSKALLLAACGAGKTLGAWKWAEQQSREYEIGKVIFLYPTRGTATEGFRDYVG
WSPATDAALVTGTARYELEAMQENPTEAIEGKDFQADERLYALGFWSRRYFSATVDQFLS
FLEHSYQSICLLPVLADSAVIIDEVHSFDRRMFDSLVSFLENFDIPVLCMTATLPPSRRE
RLKKAGLTVYPTTADRDLLPDLEEKESHPRYYLEPVDKFAAAFEKAVTAYQQGKRVLWVV
NTVDRCLAIAQKLNAINTQVLTYHSRFRLQDRQKVHAKTVAAFALQKDPDARKPAIAVTT
QVCEMSLDLDADVLITEIAPIPSLVQRFGRANRHLARGLDFQAKLHTYTPPNHLPYQKDE
LEDAKQFLQSLSHKTVSQRQFAEALEHYSPPEREADGSAQFLESGYYAIPSNFRDTDDFS
VPCILDQDLDTVKAILDSPAKHQKERFIINVPKKWANSKDSYPSWLPKYLSVATWEGHYN
EDSGFITKSLEEVELG
Download sequence
Identical sequences K9XHP6
gi|434393779|ref|YP_007128726.1| WP_015189436.1.9315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]