SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|434393929|ref|YP_007128876.1| from Gloeocapsa sp. PCC 7428

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434393929|ref|YP_007128876.1|
Domain Number 1 Region: 7-63
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 3.63e-16
Family 7-Fe ferredoxin 0.0000945
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|434393929|ref|YP_007128876.1|
Sequence length 82
Comment Photosystem I iron-sulfur center [Gloeocapsa sp. PCC 7428]
Sequence
MSHSVKIYDTCIGCTQCVRACPTDVLEMVPWDGCKAGQIAASPRTEDCVGCKRCETACPT
DFLSIRVYLSNAETTRSMGLAY
Download sequence
Identical sequences A0A1U7HZZ9 A0A2G7GHX7 K9XI28
WP_015189585.1.78850 WP_015189585.1.9315 gi|434393929|ref|YP_007128876.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]