SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|434394064|ref|YP_007129011.1| from Gloeocapsa sp. PCC 7428

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434394064|ref|YP_007129011.1|
Domain Number 1 Region: 285-333
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000000538
Family AraC type transcriptional activator 0.011
Further Details:      
 
Domain Number 2 Region: 232-283
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000003
Family AraC type transcriptional activator 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|434394064|ref|YP_007129011.1|
Sequence length 334
Comment transcriptional regulator, AraC family [Gloeocapsa sp. PCC 7428]
Sequence
MKTITEAEYMEQWEASLQKHYLAYNVDGFDRVGKCRHQYSQDYFWELQLRPGLMVEFIQD
DYHRSLSKENTHDDSMTVLVSKFYLSGVHQVLTPGIKGVKEDYEEKAGYNYLFFLPNIKE
IEISPANQRLQFLRIILELDLFHAFSTDFDILPDELQPLKESNSAPRFHQVVGKITAKMR
NTLWEILNCPYHGMTKRMYLESKTLELLVLQLHQWSDDRNSTLTRTLQREDIERLYYARE
ILSRNLNNPPSLINLARQVGLNDYKLKIGFRQLFGTTVFGYLQACRMEQAKQLLNERSLS
VAGVAHAVGYASQSRFCHAFKRQFGMTPSTYRRV
Download sequence
Identical sequences K9XIF7
WP_015189720.1.9315 gi|434394064|ref|YP_007129011.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]