SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|434394094|ref|YP_007129041.1| from Gloeocapsa sp. PCC 7428

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434394094|ref|YP_007129041.1|
Domain Number 1 Region: 259-510
Classification Level Classification E-value
Superfamily PP2C-like 1.83e-44
Family PP2C-like 0.00014
Further Details:      
 
Weak hits

Sequence:  gi|434394094|ref|YP_007129041.1|
Domain Number - Region: 9-34
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.022
Family Ran binding protein zinc finger-like 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|434394094|ref|YP_007129041.1|
Sequence length 763
Comment protein serine/threonine phosphatase [Gloeocapsa sp. PCC 7428]
Sequence
MQNEAAMLQCPNEYCKAVNDERDKYCQQCGTFLPKRYLWAVGSDIEKYQIGEVIAQRYLL
TSERVFLDTKPGLPSEAQACEITATTKPYLRLIPYRLQVPQVYGFLPGRADCDVLLLEAP
IYAEGTPLAGQLLPALAEAWQGATSLRQLNWLWQIAQLWQPLSSEGVASSLLDLQLVRVE
GSLVRLLQLRSQQPQPTIAELGRLWLELVDQAQPSIAEFLAQLCHSMIEGNLNADSLTTA
LDRGLTELGRSQVRKLVISTLTDTGPTRQRNEDACYPPSGTTTTSAPAVAIVCDGIGGHE
GGSVASQLAIDTLQQVKQLPLNDIHLDAMTLTRELERFVRIANDRINQRNDNEQRFGRQR
MGTTLVMAVERAHEMYITHVGDSRAYWITRTGCHQLTLDDDVASREVRLGYSLYRNALEQ
ASSGSLVQALGTSSSAALHPTVQRFVLDEDCIFLLCSDGLSDYDRVEEYWDTVLLPAVNG
SLKEADAVTRLVEISNSQNGHDNVTVALVRCTLKYSEPTKPLSIALLKEPQFDARQNTAI
ASQHDLIKQDRPDTSTRKTVLLPTQRPKSRLLLPILLGTILLLSLSGGLLAYFLPQFYRR
QPLNNPTTLPSPLASPTATPTPLSVGTLVQINRQINLEQNPNAIATNIASQSQLAQVPTN
GILKVTGKKENLQQGDLLRLKFLCVINPSENFNTTAQLIQLGQEGWIEQATLLPNIEKTL
GQTKSNSCPIANQSLPTSESPLNRPLTLPNAGRKNEEKRLLSF
Download sequence
Identical sequences K9XII8
WP_015189750.1.9315 gi|434394094|ref|YP_007129041.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]