SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|434394306|ref|YP_007129253.1| from Gloeocapsa sp. PCC 7428

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434394306|ref|YP_007129253.1|
Domain Number 1 Region: 527-655
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000226
Family Beta-D-xylosidase C-terminal domain-like 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|434394306|ref|YP_007129253.1|
Sequence length 837
Comment hypothetical protein Glo7428_3624 [Gloeocapsa sp. PCC 7428]
Sequence
MATDLLNPSTNSTTSPNTSNLNTGYTSLQASTADPYGFSSMNQSAIGGSSLQVLTPDANI
VSNRIVFGTVAGEVRSPKTLTLNNTGSTPLTIALNLGDSQEKSNAVRLADHQRAADFQIL
DAPTGQPFTLGANQSRTIQVQFAPQRAARLSTTPTTHTFNGENYASLTINANGQPAKTVN
LAGLNAANYEANREPSLAEITRIFGWTTNIGTESLVIGGQKQLIGDEVYSPYWVRADNSK
PVQLWPLAVFSGPTDGPHDPIRFQAKPGSGGQSGFIYQHAGRLQADNVLGSNDISGGENQ
KILPKILVGGVNTTPTLGNVSFTPNSPFALNRSLFAPTSEGAWTDYTQNLPDQTHNWRIY
PVRDAQGTLIPHTWIAAADPGNDNSAPPKNYDYNDDIYLFVNAKPENSALDPSVGGRFPG
SPDLQFYFGKTYENVFPNSLKDQNGKNIGFTSTQLNKNDTFTSIASYNPNLINLDTTGSG
TLKITTTGGSNGSKDNTLVNGLQTIFDGRASKSVISSKLLGPFNNIKAGFQQAGVMLGPD
QDNYIKVVAIAGNNGQLGIQFYQENKGVGKTIGTAAIANPGSLQSLELKLFTDPQAGTVR
AGYSVGNNNNIVLLPGVVSLKGGQIGRYFAAQSKAGLITSNKGAAPFTATFDNFLISANE
TTAQRQVLHRVNVGSSSSYTSPSGFVWSADTGLFSPSNAVPESTLGTPNIQNTNIDPVYR
SYRAKIGNGSIPMSSRVLSFALPVQPGKVDLRLHFSENYWGAPNRGPGGIGKRVFDVIVE
NKTLLHNFDITAAAGGALKAVKVPIEGVQVNDGQLNIQLKADVDFGALSAIEVFRSA
Download sequence
Identical sequences K9XHW7
WP_015189962.1.9315 gi|434394306|ref|YP_007129253.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]