SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|434394307|ref|YP_007129254.1| from Gloeocapsa sp. PCC 7428

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434394307|ref|YP_007129254.1|
Domain Number 1 Region: 234-457
Classification Level Classification E-value
Superfamily Kelch motif 1.7e-50
Family Kelch motif 0.0006
Further Details:      
 
Weak hits

Sequence:  gi|434394307|ref|YP_007129254.1|
Domain Number - Region: 408-569
Classification Level Classification E-value
Superfamily NHL repeat 0.00243
Family NHL repeat 0.036
Further Details:      
 
Domain Number - Region: 82-227
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0348
Family Legume lectins 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|434394307|ref|YP_007129254.1|
Sequence length 719
Comment Kelch repeat type 1-containing protein [Gloeocapsa sp. PCC 7428]
Sequence
MPTYLSLDFSTGVPGSVADKNGLGTGFTSVQANSSGDAYDLSLINLDTASSSLVLTATQG
SNAAANNLKNALQVAVDTITQPFRISTRLKGPVTNLNAAYKQGGIFLGSDQDNYAKLVVV
NDGKDLKLQFYNEQNGSGTSIGEIKGLNWAGVQTLDLYLTGNPQTKTLTAAYRVNSNSAL
PTTLQQVQLNNAAAASLFANSATARAGILAFTGQSKKVDVTFDYFGVNSLGSPNPDFNQI
NWSSAKSSPLGRTEASGIVANNKLYVFGGYIDNTFTPTKQSHVYNPATNAWQRIADLPTA
ISHAGIAVAGNNIYLAGGYPGKEPKGQTFATNEVWRYNTVQNKWFSMPSLPAARGSGELA
VLNGRLHFFGGVNANRIDQGNHWVLPLNGSQWTSLAPLPNPRSHMADAVVGGKLYAIGGQ
VGKEHEGAQATVNIYHPETNTWKSAKSLPQALSHISASTFVMDGKIIVAGGMLADGKDIS
EVKAYDPLSNSWSTLSPIPAPRSSGVAGRIGNNIFFATGASPGFSATTFKGAPIKNQVVS
NNAQALYRINVGSSTAYTDSNGNTWSPDTGLFNSQSAPALNGGPLNPAPAIANTLDDTLY
QSFRGKVGASNTPLASRVLSLNLPIDAPQSVDVRLHFAELYYGAPGRAAGGAGKRVFDVI
AEGQTVLKNFDIFAASGGALNAVVVPINGIQVNDGTLNLQFAAQQDFASIAAIEVLAAT
Download sequence
Identical sequences K9XJ33
WP_015189963.1.9315 gi|434394307|ref|YP_007129254.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]