SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|434394308|ref|YP_007129255.1| from Gloeocapsa sp. PCC 7428

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434394308|ref|YP_007129255.1|
Domain Number 1 Region: 232-478
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 1.44e-44
Family Galactose oxidase, central domain 0.0041
Further Details:      
 
Domain Number 2 Region: 431-572
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 0.00000157
Family DPP6 N-terminal domain-like 0.051
Further Details:      
 
Weak hits

Sequence:  gi|434394308|ref|YP_007129255.1|
Domain Number - Region: 82-226
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.038
Family Legume lectins 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|434394308|ref|YP_007129255.1|
Sequence length 721
Comment Kelch repeat type 1-containing protein [Gloeocapsa sp. PCC 7428]
Sequence
MAADLSLDFSTGVPGSVADKNGLGTGFTSVQANSSGDAYDLSLINLDTASSSLVLTATQG
SNAAANNLKNALQVAVDTITQPFRISTRLKGPVTNLNAAYKQGGIFLGSDQDNYAKLVVV
NDGKDLKLQFYNEQNGSGTSIGEIKGLNWAGVQTLDLYLTGNPQTKTLTAAYRVNSNSAL
PTTLQQVQLNNAAAASLFANSATARAGILAFTGQSKKVDVTFDYFGVNSLGSPNPDFNQI
NWSSGAAMPVGRTEAGSAIADGKLFVFGGYSGSWRPSSRSDVYDPQTNTWSQIADLPKPV
NHIGTAVDGKNIYIAGGYLAKDPVGQIFATQDVWKYNIDTNSWSPMPALPEARASGGLAV
VNGKLHFFGGADINRQDKGNHWTLDLNGGTSWSAAAPLPNPRTHMGDVVLGGKIYAIGGQ
HGVDENLVTQSSVHVWDPANPNEWREVASLPKARSHISSSTFVMDGKIIVAGGEFAHEKF
SADVTAYDPLSNTWQALTPLPQARLAGVAASFGNKILFTGGHPAFSATSFQGSPVINNQQ
NQKAQTLYRINVGSSTAYTDSNGNTWSPDTGLFNPQLAPALNGGPFNPTPAIANTLDDTL
YQSFRGKVGASNTPLASRVLSLNLPIGAPQSVDVRLHFAELYYGAPGRAAGGAGKRVFDV
IAEGQTVLKNFDIFAASGSALNAVVVPINGIQVNDGTLNLQFAAQQDFASIAAIEVLSAS
S
Download sequence
Identical sequences K9XHJ7
gi|434394308|ref|YP_007129255.1| WP_015189964.1.9315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]