SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|434394309|ref|YP_007129256.1| from Gloeocapsa sp. PCC 7428

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434394309|ref|YP_007129256.1|
Domain Number 1 Region: 231-388
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.15e-29
Family YxiM N-terminal domain-like 0.0056
Further Details:      
 
Domain Number 2 Region: 523-803
Classification Level Classification E-value
Superfamily Soluble quinoprotein glucose dehydrogenase 3.66e-19
Family Soluble quinoprotein glucose dehydrogenase 0.0022
Further Details:      
 
Domain Number 3 Region: 38-225
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000301
Family Legume lectins 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|434394309|ref|YP_007129256.1|
Sequence length 935
Comment glucosyl hydrolase family protein [Gloeocapsa sp. PCC 7428]
Sequence
MLNLDFSFALPDTILDKDGQGTGFTSVEPNSSGDQYQPSNIDLNTATKTLTLTATKGSSA
WANNSLKNALQRGIDDTKPFTINTRLKGSPTKFTSAFQQGGIFFGSDQDNYVKLVLINTG
GSNGLRLQFFKEENGVGSSIAEITNLNWSNINTLDLYLTGDPDTKTFKAAYRVNSNTAPA
QVVNQSAQIQANTPFFLANSGNTTAGILASTSNAPNVAVAFDQFGIAQEIKVNFQPDAAN
LPSGYVKDTGAAFNNTRGYGWVRSGTNTPFNIAQFARDRDRAGVDQRIDTLLHMQYFNSP
AAAWEMAVPNGMYSVSVSVGDGPNPNGVYDSKHTIRVEGVTAINQFQSTPQQEYKLETVK
VNVNDGRLTIDAIGGTNTKINFIEIFNITPGKHPNVTGFAVDRDPQGKAFLNTSINVDVA
LARSGIGVDPSSLNSSTVKLYRTKDGKQVPGLVGTSGGNDVIVYQPSQNLDANTNYTLIV
TNKVKDESGTSFNTESFTFNTGNSSTVPRDFRVNFTKESVYQGAPIASLTVGPDGKLYAA
GLDGKIRRWNIDAGSGRLSNLQTFAPAKLNGRAIIGLTFDPKNPNNLWISHNDPLFPQPA
KDFTGKISKLVLNQNTNSFSANVQDYVTGLPRSAKDHLSNSLAFGPDGKLYLSQGSNSAL
GAPDTAWANRPERLLTAAILQIDPNRNAPTGGFNIQTESYGGKQGNYNPFASNAPVKIYA
TGIRNAYDLVWHSNGFLYVPTNGSGANGNTPDNPKTSVNEALQKVGTQNDYLFKVVQGGY
YGHPNPKRGEYILNGGNPTNGVDPAEVVRIVDPVTKVAYAGYPVGIKPDSNYRGFAYDFG
RNKSPNGVIEYQSNTFGGALKNKLLVVQYSGGNDILALDPNESGNIPRGNVTQVISGLND
PLDLVEDTKKNAGNLYVAELIKDGVAGQISLLKVS
Download sequence
Identical sequences K9XJ72
gi|434394309|ref|YP_007129256.1| WP_015189965.1.9315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]