SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|434394349|ref|YP_007129296.1| from Gloeocapsa sp. PCC 7428

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|434394349|ref|YP_007129296.1|
Domain Number - Region: 5-34
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00429
Family Classic zinc finger, C2H2 0.048
Further Details:      
 
Domain Number - Region: 27-60
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.00884
Family PhnA zinc-binding domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|434394349|ref|YP_007129296.1|
Sequence length 81
Comment hypothetical protein Glo7428_3670 [Gloeocapsa sp. PCC 7428]
Sequence
MPSKKVHVREYTVRAHERVIHTRLYKFICKQCNKDAERETYGPRPLYCEQCRPSMTHSTK
VAKKKKPRPVLVKQQKRRRAG
Download sequence
Identical sequences K9XJA6
WP_015190004.1.9315 gi|434394349|ref|YP_007129296.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]