SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|434394519|ref|YP_007129466.1| from Gloeocapsa sp. PCC 7428

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434394519|ref|YP_007129466.1|
Domain Number 1 Region: 5-43
Classification Level Classification E-value
Superfamily TTHA1013/TTHA0281-like 0.00000000288
Family TTHA0281-like 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|434394519|ref|YP_007129466.1|
Sequence length 62
Comment hypothetical protein Glo7428_3850 [Gloeocapsa sp. PCC 7428]
Sequence
MKQKYIYWQDDDMWLGFLEEYPDYWTQGETEEELRDNLLDIYNELTSGTIPNVRKVAELE
VL
Download sequence
Identical sequences K9XJR7
WP_015190174.1.9315 gi|434394519|ref|YP_007129466.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]