SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|434394851|ref|YP_007129798.1| from Gloeocapsa sp. PCC 7428

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434394851|ref|YP_007129798.1|
Domain Number 1 Region: 21-346
Classification Level Classification E-value
Superfamily Pectin lyase-like 2.04e-32
Family Filamentous hemagglutinin FhaB, secretion domain 0.011
Further Details:      
 
Domain Number 2 Region: 429-522,553-579
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000000261
Family Filamentous hemagglutinin FhaB, secretion domain 0.042
Further Details:      
 
Domain Number 3 Region: 321-430
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000628
Family Filamentous hemagglutinin FhaB, secretion domain 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|434394851|ref|YP_007129798.1|
Sequence length 858
Comment filamentous hemagglutinin family outer membrane protein [Gloeocapsa sp. PCC 7428]
Sequence
MKLRCQSFWCPTSFLLFLTISSPLQAQIIGDQTLPNPSSVTTEDVNSIITGGTQAGSNLY
HSFSEFSVPTNGVASFQNLAPEIENVITRVTGAASNIDGLIEVLQADGVVSSANFFLLNP
RGITFGSNALLNIGGSFIASTASSLNFADNTQFFSANLTQAESILSMSVPVGLQFGVNPG
RILNQAQTTIDIEGQIIPIGLQVLPGKTLALVGGDVTLESGVAIAPAGRIEIGSVGSFSF
VSLNPTNSGWYLDYTGVQNFQNIELSQQSLVDVSGEGTGNIQIQGKQVAIAEDSFVIAAV
ESQNGGEIFIQASDLTIDSSLIGTSTDNGIGANVIIETGKLVIVDGQVLTRTRSAGQGGE
LKITASESVEVVGGRSIPRGNGEFSFFPSRLLTEADETATGTAGNLSLNTNKLSLQNGAQ
VGSATFGAGNTGNVNVQASEIDIVGVARTPEGEPISDAGLPFPSGLFASTEEGYSGNGGN
LTVTTDRLSIRDGAVVQTTTFGSGDAGNLTIQAAQSIEVAGTVNVEGQDLKSGLFANSGG
LPGTGLPAIFDATGRGGNLTIQTDELIVRDGAIVAVSSVNETTAAQGAGNLQVNAQTIRL
DNGEIVANTASGQGGDINLNVQDVFLRRNSAISTTAGIEGTAGDGGDISITNARFIIAAP
NENNDIKANAFLGQGGKVTVDAQNIFGLTVRSLEDLQTLLGTTNPQRLDPVQLPSSDITA
ISQTNPQLSGEVVINTPDVDPSRGAVVLPQNLVDVSGLIAQGCAAGNVANESQFVVTGRG
GLPPNPGEVLSSDDVWQDWRFSNATAGVTSISASTPRTTSTPLVEATNWATNSKGEVMLI
AAMSTNTVNPGQGVISCR
Download sequence
Identical sequences K9XJG6
gi|434394851|ref|YP_007129798.1| WP_015190505.1.9315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]