SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|434394896|ref|YP_007129843.1| from Gloeocapsa sp. PCC 7428

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434394896|ref|YP_007129843.1|
Domain Number 1 Region: 115-254
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 3.14e-25
Family GntR ligand-binding domain-like 0.0076
Further Details:      
 
Domain Number 2 Region: 42-113
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 9.97e-16
Family GntR-like transcriptional regulators 0.03
Further Details:      
 
Domain Number 3 Region: 312-354
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000125
Family Cgl2762-like 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|434394896|ref|YP_007129843.1|
Sequence length 374
Comment transcriptional regulator, GntR family [Gloeocapsa sp. PCC 7428]
Sequence
MGDLGGEKLCIEITNYIDVKLGKVLKTVRYTGDVRLTSQLPQRSKPLYEQTYLALRSAIL
SGEISVDERLIESQLAQRFQVSRTPVREAIRRLQQENLLASDSDGALCITKLSLRDAIKL
YDCRIALEQLSVVGACENATTEQLKAIEQTLIQAENLAQQGHKQLQDELLDLNFDFHRLI
AESSDNPWLVPLLDHLSNHTRLLRTQTLQAEPDITNIHSEHRQVYEAIAHHDVPAAVKYI
THHLTASQQRIIEIFERSHLTTLSAEMIPQQEALQCPRCLSFEVSRNGRRMGKQGYICKQ
CGRQFLATYESSRYSAEIREKCIVLHNNGIGFREIERMTGVNHNTIIRWVKSAPHKAYKS
NYSRGQESEVGSQG
Download sequence
Identical sequences K9XJL0
gi|434394896|ref|YP_007129843.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]