SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|434395092|ref|YP_007130039.1| from Gloeocapsa sp. PCC 7428

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434395092|ref|YP_007130039.1|
Domain Number 1 Region: 33-161,196-365
Classification Level Classification E-value
Superfamily Pectin lyase-like 9.73e-43
Family Filamentous hemagglutinin FhaB, secretion domain 0.0084
Further Details:      
 
Domain Number 2 Region: 572-620,654-683
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000000565
Family Filamentous hemagglutinin FhaB, secretion domain 0.06
Further Details:      
 
Domain Number 3 Region: 365-478
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000000534
Family P22 tailspike protein 0.055
Further Details:      
 
Weak hits

Sequence:  gi|434395092|ref|YP_007130039.1|
Domain Number - Region: 488-510,545-571
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000173
Family Filamentous hemagglutinin FhaB, secretion domain 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|434395092|ref|YP_007130039.1|
Sequence length 922
Comment filamentous hemagglutinin family outer membrane protein [Gloeocapsa sp. PCC 7428]
Sequence
MYFLLFLNKIAIYLKQIKLLLFIGIASKSFCLAPASAQIIPDETLGSEKSVVTSIAPASI
DLITGGATRGINLFHSFQEFNVDAARSVYFANPQGIENILSRVTGKNPSSILGLLGVQGE
ANLYLINPNGIIFGTDAILNVQGSFVATTANAVQFGNQGIFNTSNPTAVPLLSVNPSAFL
FNQLVPNSFIYQAASFLQVPESNSLIFLGGNVTIDSGVLLAPSGRVEVGGLAAEGEVELT
INSSNLNLGFPTNVAKADVLLTNAAGISVAGEGGGSIEVNARDINLLGTSALLAGIQPKL
GSVDTQAGDIILDGTGQVTVGEFSLIGNFVSPDSTGSGGNIYIKTSTLSVTEGAQISTAT
FGQGNAGSIEINTRDTVNIAGFNEGYSSGIFSTINANGNAGNISVKTTDLFLVDGAQIVA
NTFGKGNAGSIFVQANNVSLDNASGILSSVSSGAVGDGGDIQIQTRSLSLTNGSQIQALV
FREQGDIPGGQGKGGNITINATESVDLIGISSVQLPIINPLNDSEFIATEGFSSGIFTST
EKGAIGSGGNIAINTRSLQVRDSAIVNAQTLNSSDGGQITINTNTFTATEGGQVLTVSRD
RGKAGNITLTATESVTLSGSDPSFFERFERFGRDIVNNEGAASGLFASTDTDSTGNGGTI
SLATGNLLVSDRAKISAQSLGTGIAGNINIRADESINADDGEIATSASQSVGGAINVVAG
DIRLHGDSDIRTNVASGAGGGGNITLSASSILAFDDSDILAFARDGQGGNITLNTPVFFA
GNFQPAAFNTNPDNLDGNNRVDINASGAVAGVVEIPDVSFIQNSLIDLPENLINTDTLIA
NSCIARTQQGGTFLITGAGSLPSRPGDSVSAYSTGSVQSIPDTSSRPWRLGDPIVEPQGI
YRLGNGRLLLSRECLRSPDNNS
Download sequence
Identical sequences K9XLD2
WP_015190746.1.9315 gi|434395092|ref|YP_007130039.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]