SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|434395097|ref|YP_007130044.1| from Gloeocapsa sp. PCC 7428

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434395097|ref|YP_007130044.1|
Domain Number 1 Region: 27-367
Classification Level Classification E-value
Superfamily Pectin lyase-like 9.42e-31
Family Filamentous hemagglutinin FhaB, secretion domain 0.0051
Further Details:      
 
Domain Number 2 Region: 622-722
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000000279
Family Filamentous hemagglutinin FhaB, secretion domain 0.084
Further Details:      
 
Domain Number 3 Region: 727-886
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000000033
Family Filamentous hemagglutinin FhaB, secretion domain 0.069
Further Details:      
 
Domain Number 4 Region: 891-1012
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000107
Family Filamentous hemagglutinin FhaB, secretion domain 0.06
Further Details:      
 
Domain Number 5 Region: 1082-1229
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000289
Family Filamentous hemagglutinin FhaB, secretion domain 0.077
Further Details:      
 
Domain Number 6 Region: 986-1075
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000675
Family Filamentous hemagglutinin FhaB, secretion domain 0.064
Further Details:      
 
Domain Number 7 Region: 395-606
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000091
Family Filamentous hemagglutinin FhaB, secretion domain 0.03
Further Details:      
 
Weak hits

Sequence:  gi|434395097|ref|YP_007130044.1|
Domain Number - Region: 1228-1275,1312-1333
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000345
Family Filamentous hemagglutinin FhaB, secretion domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|434395097|ref|YP_007130044.1|
Sequence length 1491
Comment filamentous hemagglutinin family outer membrane protein [Gloeocapsa sp. PCC 7428]
Sequence
MNNSKLGLSGLQLVLTVIIGAIALSQTCVQAQITPDTTLSSENSVVTPNVVINGISSNRI
DGGAIRGANLFHSFQEFNIDAGRGAYFSNPAGIDNILSRVTGDNPSNILGTLGVLGNANL
FLMNPNGIIFGQGASLDIQGSFVASTADRIQLGDSGYFNATEPQQSHLLAITPGALFFNQ
VASDPGNIINTGNLAVGKNLTLSADNLNLQGQLLAGENLTLQANDTVQVRDSVANPFIAA
AGEKLLVQGQAIDIFALNNPNSGLFAGKDLVLRANTVGGDAHFWSGGNFRIEQLDGSLGD
WYSPYDPIIFVAGDLFFNNYFGASLHILAGGSVFVPGTVYIIDADTPSTAIAEDVTLSDG
TVLPIDGSDRPTLDIRAGVDPAIVSSPDGIAVIGSGLFFGGAYDINPSSADISIGNIIIE
PPNGVVYLTNQYQPNLSLTSANIEITGKGISRIGVEFQSLGIDARGFGGNGSAVVLDSRG
SIFLNQNASIDSSSDMNKAGNISLIADEIQLAPFASIFANGSGGDIHIQGNRLLMQEFSG
ISALTTGTEDGGNIFIQANDSVRIDGGNIGTIVGLGPSQFGSPLVSGNGGDITIKTGELT
VTGTALFVGDLFPGGFRTGGDITSDTGSLGNAGTVTIDARQVSLTNGAQIRASTFSIGNA
GDVIIRASEFVEVTGVSSDDNFSVSKIASQVTPIGSGTGGDVLIETNRLMVSDGAQIQAG
TFSTSSGGSLTVNATQSIDIFDTLIDDKPTGLFTGPEGSSASGTGGALTVRTEQLSISGG
ETNISSEVDFEASGNAGNLLIEANRLIIGDGAQISAATYGIGQSGNLTVKASESINLFGV
DTTEDGEPSGLLTATFGGGDAGNLTIQTRQLSIRDGATISSSSAGLFGNGKSGNVTIEAS
DSVEVIGEASDGQYFSSIVAETGRLFGIPIPFSQAAGENIQITTRQLSVLDGAEISTQTF
GAGNAGDLSINASESVQLVNGYLRTRTGGAGNAGNMDITTQRLTVQGGEATAATEGPGQG
GSMVINASNSVDLIGFGGLGSVSIFGGDAGDLTIATQKLSIRDGAGIATSSFGLGQAGDL
RIVNADTVEVIGGLWNTGAEVLDGIADFISGTSGNIEPTELIFLPSRITTEAASTSDNSA
GDLTIQTNQLIVRDGAEVTTTTLGENSGGTLSITASELLEVSGTSMTGDRSRLSARTIND
GNAGDILITTGQLNVLNQAEVSASTSGNGQGGNIDIQAGSVRLSDRAQINASSQQQGNAG
SITINADGFIESTNSDILTFANQASGGAIAISAQGIRLRGDSDIQTNVASGTGGGGNITL
TANSILAFDDSDILAFAQDGRGGNIALNTPVFFGENFQPAAVNSNPNTLDGNNRVDINAT
GAVAGVVNIPDVSFIQNSLIELPANIINTETIVANSCVVRSRNQAGNFLITGTGGLPTRP
GEQAASTYSTGSVRSIPDASSRTWQLGDPIVEPQGAYRLSNGQLILSRECS
Download sequence
Identical sequences K9XLD7
gi|434395097|ref|YP_007130044.1| WP_015190751.1.9315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]