SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|434395124|ref|YP_007130071.1| from Gloeocapsa sp. PCC 7428

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434395124|ref|YP_007130071.1|
Domain Number 1 Region: 2-231,348-390
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.11e-40
Family FAD-linked reductases, N-terminal domain 0.0076
Further Details:      
 
Domain Number 2 Region: 251-344
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.000000000484
Family D-aminoacid oxidase-like 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|434395124|ref|YP_007130071.1|
Sequence length 392
Comment FAD dependent oxidoreductase [Gloeocapsa sp. PCC 7428]
Sequence
MSHVLIIGCGVIGAAIAYELSLSGLEVTVLDRQPPAQAATGAALGVLMGAISHKIKGNAW
QMRAASIKRYETLIPELEAVIMRRIPFNRQGILMLCFQEEDLAGWEKLAAVRSAQEWQLE
IWNAAQLQSRCPQLNSEKITAAIYSPQDRQVDPVALTLALVEAAKHKGVQFHFGVTATGY
YLDNADQRMYLQIENAQLSEKIKDVDWLVIAAGTGSTPLQWRQESTSRDRTPIALTFAPT
QQAQSTPAVEIKPVLGQAIHMRVNQPLGDPNFQPVITGDDVHIVPCLSSQPMTDYWVGAT
VEFSANGQVVADATQLEKVKQQAIAFCPALAQAKIIRTWSGLRPRPEGQPAPIIRHVPGF
DNILLATGHYRNGVLLAPATAEKIREIVMRGE
Download sequence
Identical sequences K9XLG5
gi|434395124|ref|YP_007130071.1| WP_015190778.1.9315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]