SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|434395187|ref|YP_007130134.1| from Gloeocapsa sp. PCC 7428

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434395187|ref|YP_007130134.1|
Domain Number 1 Region: 27-243
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.61e-68
Family ABC transporter ATPase domain-like 0.00000572
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|434395187|ref|YP_007130134.1|
Sequence length 245
Comment Sulfate-transporting ATPase [Gloeocapsa sp. PCC 7428]
Sequence
MSIISRTLVDPKSIKLTNQRKTKAILTKGVEMAFRSGRECFQVLKGIDLDVSPGDIQLLM
GPSGSGKTTLLSILAGLLTPTAGSVYLLGEEITKMSREKLARFRLENIGFIFQGFNLFPA
LTAAENVELVLNIKGIKGRLARNQAKYLLEQVGLASHTNYKPGDLSGGQKQRVAIARALA
GNPQLIMADEPTAALDSRSGHNVIELLRVLAKEEGCTVLMVTHDPRIIDVADRVAYMEDG
ILRQE
Download sequence
Identical sequences K9XLL8
gi|434395187|ref|YP_007130134.1| WP_015190841.1.9315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]