SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|434395269|ref|YP_007130216.1| from Gloeocapsa sp. PCC 7428

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|434395269|ref|YP_007130216.1|
Domain Number - Region: 6-42
Classification Level Classification E-value
Superfamily Ribbon-helix-helix 0.00206
Family SeqA N-terminal domain-like 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|434395269|ref|YP_007130216.1|
Sequence length 93
Comment hypothetical protein Glo7428_4620 [Gloeocapsa sp. PCC 7428]
Sequence
MANPFLGVRIPPELEQAILARMKETGQSKSEIVISALRSYLGMMSCHERLDNVDQRLSAL
EKGVKEALELMVLYRQKHSVYPTNHSFDRHSDV
Download sequence
Identical sequences A0A1U7HV33 K9XLW9
gi|434395269|ref|YP_007130216.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]