SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|434395336|ref|YP_007130283.1| from Gloeocapsa sp. PCC 7428

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434395336|ref|YP_007130283.1|
Domain Number 1 Region: 4-80,176-340
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 7.86e-44
Family Bacterial dinuclear zinc exopeptidases 0.0043
Further Details:      
 
Domain Number 2 Region: 70-184
Classification Level Classification E-value
Superfamily Aminopeptidase/glucanase lid domain 0.0000000000000519
Family Aminopeptidase/glucanase lid domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|434395336|ref|YP_007130283.1|
Sequence length 344
Comment peptidase M42 family protein [Gloeocapsa sp. PCC 7428]
Sequence
MYDEIFNRIEELVMHHSPSGAEAEINQLLLQKFAASVEVWHDRADNVIAKIPGQDASRAI
AITAHKDEIGAIVKTVGDAGQVEVRRLGGSYPWIYGEGVVDLLGDNETISGILSFGSRHV
SHESPQKELQEDTPVKWENAWIETKCTPEELNAVGIRPGTRVVIGKHRKRPVRIKDHIAS
YTLDNKASVAILLALAEQVKQPVVDIYLVASAKEEVGAIGALYFSQRQHLDALIALEICP
LAPEYPIKSGEAPVILSQDGYGIYDETLNGQLRQVAQKLEMPVQLATLSGFGSDASIAMK
FGHVPRAACLAFPTQNTHGYEIAHLGAIANCIQLLQAFCETPFD
Download sequence
Identical sequences K9XKV2
WP_015190990.1.9315 gi|434395336|ref|YP_007130283.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]