SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|434395507|ref|YP_007130454.1| from Gloeocapsa sp. PCC 7428

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434395507|ref|YP_007130454.1|
Domain Number 1 Region: 57-263,368-471
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 3.89e-70
Family Bacterial dinuclear zinc exopeptidases 0.0000728
Further Details:      
 
Domain Number 2 Region: 248-351
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 5.23e-27
Family Bacterial exopeptidase dimerisation domain 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|434395507|ref|YP_007130454.1|
Sequence length 472
Comment amidohydrolase [Gloeocapsa sp. PCC 7428]
Sequence
MSRFRHFFLNQWLKSMIGVIASSLLLGLTLLLLSLHPAQAQKPFTGTPAVKPAYFDRLLA
TIDKDRDRLINLFKDIHQNPELAFMETRTAAIVAKELKALGYEVKTGIAKTGVVGILRNG
DGPKVMYRADLDALPVQETTGLPYASTKRAEMPDGSERPVMHACGHDAHTVWMLGLAKAM
VDLKSNWKGTLILVGQPAEEGVAGARAMVEDGLYTRYSVPVPDFLLGMHSAPGPTGIIAS
VPGIRTAGSDPIDIVFKGVGGHGSSPHLAKDPILMAAHAITQYQSIVARAINPQEAAVIT
VGAVQAGEANNVIPGEALLRLSLRWFNPEVRKTMVQGIKSVNESIARAYGMPEDQLPTLT
TKGGSTPLVNDQAVIDRINPQLANLVGANKLIADFPGTTGSEDVHLLKGDNKNIQVGFVF
VGVAEPALFAKARAEGKTVPFSNHNSNFQVDLNAVPFGTKVASVMTMELLNE
Download sequence
Identical sequences K9XMG5
gi|434395507|ref|YP_007130454.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]