SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|436735924|ref|YP_007318052.1| from Gloeocapsa sp. PCC 7428

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|436735924|ref|YP_007318052.1|
Domain Number 1 Region: 1-133
Classification Level Classification E-value
Superfamily CheY-like 1.71e-35
Family CheY-related 0.00032
Further Details:      
 
Domain Number 2 Region: 120-227
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 3.12e-21
Family PhoB-like 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|436735924|ref|YP_007318052.1|
Sequence length 230
Comment two component transcriptional regulator, winged helix family [Gloeocapsa sp. PCC 7428]
Sequence
MRVLLVEDEADLGLAIKQILVSEKYVVDWVPDGSQAWHCLESQWTDYTVAIVDWLLPELS
GLELCQRLRMHQNPLPVLMLTALGQPENRIAGLDAGADDYLVKPFVMEELLARLRALQRR
SPQLQPQNLSIGAFTLDYANNALCSELAQPPQAIPLTVKEFQILAYLMQNPNRIISGSKI
RHQLWDLEEEPISNVVAAQMRLLRRKLASYGCNCPIETIPGQGYRFNTAL
Download sequence
Identical sequences K9XN00
gi|436735924|ref|YP_007318052.1| gi|436735924|ref|YP_007318052.1|NC_020051 WP_015328568.1.9315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]