SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|436735977|ref|YP_007318105.1| from Gloeocapsa sp. PCC 7428

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|436735977|ref|YP_007318105.1|
Domain Number 1 Region: 406-650,685-800
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.08e-28
Family Tandem AAA-ATPase domain 0.017
Further Details:      
 
Domain Number 2 Region: 263-356
Classification Level Classification E-value
Superfamily Homing endonucleases 0.00000000000000266
Family Intein endonuclease 0.024
Further Details:      
 
Domain Number 3 Region: 52-125,154-194,337-405
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 0.000000000000327
Family Intein (protein splicing domain) 0.081
Further Details:      
 
Weak hits

Sequence:  gi|436735977|ref|YP_007318105.1|
Domain Number - Region: 11-47
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0208
Family Tandem AAA-ATPase domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|436735977|ref|YP_007318105.1|
Sequence length 801
Comment hypothetical protein Glo7428_5139 [Gloeocapsa sp. PCC 7428]
Sequence
MTAQILSIPQLPFQLTCDQEQALKAILEFLDSDQTLFLLGGYAGTGKAQPIHTPVLTPTG
WIPIGQLKPGDFVIAGDGSRTRVIGIFPQGVKPVARIKFNDGSSTLCCYDHLWLTESYHE
RNANRVRVYKAQKKGRIPQPKKGRVKTTREIAASLSARNGLQSNHRIPVMQCADFEPSTV
PIAPYLLGCLLGDGGLTSNTPQLTTNDAEIITRCREIIPEDVDMRIIIQREYRFVGTQWR
GQYRHNPLTESLKSLGLWGKYSYEKFIPQCYLINSKEVRLELLRGLMDTDGTVSQEGYET
SFATSSPQLAADVRSLVESLGGICPIQTRNTASGRLCYRLSICLPPDINPFHLPRKRDRV
KPKTRYAPARYIVSVEAEAEQECVCIAVEHPSRLYVTEHCIVTHNTTLVSLLVKALVGVG
KRIALTAPTNKAVNVLQRMAAKNELAGLDFFTIHQLLGLGMVTRAGEKVLERTGSSYAHA
FHIVFIDECSMIGEQLWHWIEDVASLYAPRLKIVLMGDPAQLNPVNEKKSPSFSVTNRAV
LKQVVRQGADSPLLEFVTTCRQAVTKSKQPFKPCPKYSQDKQNGVFVVRQQTLLNYACKK
MKSEFDNNPDCFRILCWTNKQVDWYNHHIRTHLYGVNAARFVIGERLIARDPIVAPDGKT
VILPTSSEFVVTDYCEDRYAGYKVWRAIATTDNDIKRQIYVLHDEERQRFDAEAQQLMQS
AKSNPFFWQKYYKHLETFANVRPCFALTVHNSQGSTFDEVAIDANDLNKRGLDGKLSSVR
ELNRLWYVGSTRARERVFIVK
Download sequence
Identical sequences K9XPD4
WP_015328621.1.9315 gi|436735977|ref|YP_007318105.1| gi|436735977|ref|YP_007318105.1|NC_020051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]