SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|434391679|ref|YP_007126626.1| from Gloeocapsa sp. PCC 7428

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434391679|ref|YP_007126626.1|
Domain Number 1 Region: 2-350
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 7.64e-76
Family TK-like PP module 0.0081
Further Details:      
 
Domain Number 2 Region: 290-480
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 9.3e-65
Family TK-like Pyr module 0.012
Further Details:      
 
Domain Number 3 Region: 493-625
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 2.75e-37
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|434391679|ref|YP_007126626.1|
Sequence length 635
Comment 1-deoxy-D-xylulose-5-phosphate synthase [Gloeocapsa sp. PCC 7428]
Sequence
MHLSEITHPNQLHGLSIRQLQQIARQIRDKHLQTVAASGGHLGPGLGVVELTLALYQTLD
LDQDKVIWDVGHQAYPHKLITGRYSQFHTLRQKDGVAGYLKRCESPFDHFGAGHASTSIS
AALGMALARDLKGEKFKVAAVIGDGALTGGMALEAINHAGHLPKTNLLVVLNDNEMSISP
NVGAISRHLNKMRLSPPVQFLSDNLEEQVKQIPFVGDSLETELERFKEGMKRLAVPKVGA
VFEELGFTYMGPVDGHNLEELITTFKQAHKIGGPVLVHVATVKGKGYAIAEQDQVGYHAQ
SPFNLTTGKAIPSSKPKPPGYSKVFAHALVKLAENNPKIVGITAAMATGTGLDKLQAKLP
QQYIDVGIAEQHAVTLAAGLACEGMRPVVAIYSTFLQRGYDQIVHDVCIQNLPVFFCMDR
AGIVGADGPTHQGMYDIAYLRCLPNMVLMAPKDEAELQRMVVTGVNYTNGPIAMRYPRGN
GYGVPLMEEGWEPVEIGKGETLRHGDDVLLLGFGSMVYPAMQVAEILSEHGIQATVVNAR
FAKPLDTELILPLAQRIGRVVTLEEGCLMGGFGSAVAEALLDADVVVPVKRFGIPDTLVD
HASPDQSKAELGLTSPQIAQEVLKAFFNKTLSSVS
Download sequence
Identical sequences K9XBL2
WP_015187343.1.9315 gi|434391679|ref|YP_007126626.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]