SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|434392777|ref|YP_007127724.1| from Gloeocapsa sp. PCC 7428

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434392777|ref|YP_007127724.1|
Domain Number 1 Region: 355-540
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.25e-61
Family Pyruvate oxidase and decarboxylase PP module 0.000048
Further Details:      
 
Domain Number 2 Region: 1-171
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.37e-54
Family Pyruvate oxidase and decarboxylase Pyr module 0.0000199
Further Details:      
 
Domain Number 3 Region: 180-361
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 2.12e-41
Family Pyruvate oxidase and decarboxylase, middle domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|434392777|ref|YP_007127724.1|
Sequence length 545
Comment Acetolactate synthase [Gloeocapsa sp. PCC 7428]
Sequence
MNTAELLVQCLENEGVRYVFGLPGEENLHVLEALKNSSIQFITTRHEQGAAFMADVYGRL
TGKAGVCLSTLGPGATNLMTGVADANLDGAPLVAITGQVGTDQMHIEAHQYLDLVAMFAP
VTKWNTQIVRPSNTPEIVRKAFKRSQSEKPGAVHIDLPENIAAMPATGNPLKTDKLERTY
AAFHSITEAATAISNAHNPIILVGNGAIRADASEAVTEFATQLNIPVANTFMGKGVIPYK
HPLALWSVGLQQRDYINCGFDNTDLVIAIGYDLIEYSPKKWNPDGKIPIVHIGETPAEID
SSYIPLVEVVGDISDSLYEILKRADRDDKPDPYALELRADIRADYEQYANDDGFPIKPQK
LIYDLRQVMGPEDIVISDVGAHKMWIARHYHCDRPNTCLISNGFAAMGIAIPGAVAAKLV
YPHRKIVAATGDGGFMMNCQELETALRVGTPFVTLIFNDGGYGLIEWKQRNQFGRSSFVH
FGNPDFVKLAESMGLKGYRVEATTDFIPILKTALAQDVPTVIDCPVDYQENYRFTQRAGE
LNCIV
Download sequence
Identical sequences K9XEQ1
gi|434392777|ref|YP_007127724.1| WP_015188437.1.9315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]