SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|434393545|ref|YP_007128492.1| from Gloeocapsa sp. PCC 7428

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434393545|ref|YP_007128492.1|
Domain Number 1 Region: 255-566
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 1.44e-17
Family Serum paraoxonase/arylesterase 1, PON1 0.093
Further Details:      
 
Domain Number 2 Region: 7-122
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.000000000000034
Family Collagen-binding domain 0.0069
Further Details:      
 
Domain Number 3 Region: 130-242
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.000000000824
Family Collagen-binding domain 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|434393545|ref|YP_007128492.1|
Sequence length 639
Comment peptidase domain protein [Gloeocapsa sp. PCC 7428]
Sequence
MVLTPDPGSTLGTAYGLSTLSGRSDVLSDAVGTSDPNDYFRFSLSASSSSLRVLLSGLSA
NADLQVIRDANFNRTVDPGEVISSSTRTGTASEQINLSNLAAGDYYVRVYQVSGDTNYNL
TLVSDAAGATMATARNIGTPPTNFTNTYRDFVGNTGTGVTDTADVYRFNVTTRSNLNAFL
TDAGTNANVQLLNSNGNFIQSALNGFDGATPAQTIARFINPGTYFLRVTPTGTNSTNYTL
KIATPPISSSLEWVKQLGTTSNFDNATDVAVDGSGNTYVVGYTTGQLLGNNAGFADGFLA
KYNSGGTLQWIREIETRTNDYVNAVAVDGSGNVYIGGKGSSAAVAANVSGDAFIAKYDGN
GNQTWLRRLGATIGLGGLAQVNDLTVDAAGNLYVTGRTANSGSTNFDAFVGKYRTSNGAT
QWFKRVGTPNSNAWDEGYGIAVDRTGAVYISGQTAGNLGTTNAGSYDAFLIKYNSTGTQQ
WIRQFGLSSNDSGNGVAVDASGNVYVTGNSFGNLGGTGTGQSYLTKFGSNGSRLWTTQFG
GNLPTGASDVKVDASGNIYVAGASQNSFGSTSYGTWDAYFLQFNSNGVMQQGTTLGTTST
DSASDIALDSLGNVYITGTTFGTLADASAGGTDVFVAKF
Download sequence
Identical sequences K9XI46
gi|434393545|ref|YP_007128492.1| WP_015189204.1.9315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]