SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|434394335|ref|YP_007129282.1| from Gloeocapsa sp. PCC 7428

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434394335|ref|YP_007129282.1|
Domain Number 1 Region: 28-452
Classification Level Classification E-value
Superfamily PLP-dependent transferases 5.72e-110
Family Glycine dehydrogenase subunits (GDC-P) 0.000000947
Further Details:      
 
Domain Number 2 Region: 493-907,950-972
Classification Level Classification E-value
Superfamily PLP-dependent transferases 7.88e-97
Family Glycine dehydrogenase subunits (GDC-P) 0.00000015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|434394335|ref|YP_007129282.1|
Sequence length 979
Comment Glycine dehydrogenase (decarboxylating) [Gloeocapsa sp. PCC 7428]
Sequence
MVAYRSGTGSIRQQLVEAAQESFSFAQRHIGSKPEEIQQMLDELGLATLDALIDQTVPQA
IRLNRPLQLEPAQSEYAALAKLKEIASKNQVFRSFIGMGYHDCVTPPVIQRNILENPGWY
TAYTPYQPEISQGRLEALLNFQTAIIDLTGLEIANASLLDEATAAAEAMAMSYGVCKHKA
NTFFVSQDCHPQTIAVVQTRAIPLGIKIIVGDHQTFTFDESVFGALLQYPATDGTIYDYR
HFVEQAHTVGALVTVAADPLSLCLLTPPGEFGADIAVGSTQRFGVPLGYGGPHAAYFATK
EQYKRQVPGRIVGVSKDVHGKPALRLALQTREQHIRREKATSNICTAQVLLAVMASMYAV
YHGPQGLKNIAQRVHQLTVLLAEGLKHLGYTITSEHYFDTLRIDLEPEQVTEIIEAALAR
QINLRTINERAIAISLDETTTEADLYDLWQIVAGSEVSFALEELATPQSALEKIQPFARS
SGYLTHPVFNSYHAETEMLRYIYRLQAKDLSLTTSMIPLGSCTMKLNATTEMLPISWQAF
GKIHPFAPLSQTRGYQILFAQLEQALAEITGFAGISLQPNAGAQGEYAGLLVIRQYHASR
GEAHRQVCLIPESAHGTNPASAVMAGMKVVAIACDKQGNIDLDDLQAKAEKHSHELAALM
VTYPSTHGVFEEQIKDICAIVHAHGGQVYMDGANMNAQVGICRPGDYGADVCHLNLHKTF
CIPHGGGGPGMGPIGVATHLVQFLPGHTVVEIGGEQSVGAMAKRPCRWQIAAAPWGSASI
LPISWMYITLMGAAGLTQATKVAILNANYIAHRLAPYYPVLYRGKSGLVAHECILDLRFL
KKSAGIEVDDIAKRLMDYGFHAPTVSWPVAGTMMVEPTESESKAELDRFCEAMIQIRQEI
AEIEAGKVDMHDNVLKNAPHTADALISSDWQHPYSREQAAYPTSWTREHKFWTTVGRIDN
AYGDRNFVCSCLPMEAYSE
Download sequence
Identical sequences K9XKD4
WP_015189990.1.9315 gi|434394335|ref|YP_007129282.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]