SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|220930856|ref|YP_002507764.1| from Halothermothrix orenii H 168

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220930856|ref|YP_002507764.1|
Domain Number 1 Region: 403-636
Classification Level Classification E-value
Superfamily Type II DNA topoisomerase 2.33e-91
Family Type II DNA topoisomerase 0.00029
Further Details:      
 
Domain Number 2 Region: 13-221
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 8.25e-73
Family DNA gyrase/MutL, N-terminal domain 0.00000169
Further Details:      
 
Domain Number 3 Region: 230-400
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.6e-60
Family DNA gyrase/MutL, second domain 0.00000527
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|220930856|ref|YP_002507764.1|
Sequence length 642
Comment DNA gyrase subunit B [Halothermothrix orenii H 168]
Sequence
MAEESFLNNKGNYEAEHIQVLEGLEAVRKRPGMYIGSTGMDGLHHLVYEVVDNSIDEAMQ
GYCDLIEVIIKPGNIITVKDNGRGIPVDPHPKLKKPAVEVVLTVLHAGGKFGGDGYKVSG
GLHGVGVSVVNALSKWLEVEVCWRDGKVYHQKYNRGIPVYDLKVIGECSGTGTTISFKPD
EEIFEDVNFKYKVLAQRLKELAFLNKGVRIILRDEREEEARQDEYCFEGGLVSFVKYLNK
NKNPLFDEPFYLEEKDENREVEIAIQYNDGYVDSIFTFANNINTREGGTHLSGFKSALTR
TVNDYARSKGILKENDENLTGEDIREGITAIISVRLTDPQFEGQTKTKLGNSEIRGFVDS
ALSSNLRTFLEENPKIGKIIVEKARSAARARKAAKKARELTRRKGALSNTALPGKLADCS
SRDTENTEIYIVEGDSAGGSAKQGRDRKFQAILPLRGKILNVEKARLNKILNNEEIRALI
TAIGTGIGDEFDINKARYGKIIIMTDADVDGAHIRTLLLTFFYRYMRPLIENGMIYIAQP
PLYKVKKGRREEYVYNDRGLQKLLNDIGRDKITLQRYKGLGEMNPDQLWETTMNPENRII
LKVKIEDAVVADETFTTLMGDKVQPRREFIQEHAHEVQNLDV
Download sequence
Identical sequences B8CZN9
WP_012634968.1.20074 gi|220930856|ref|YP_002507764.1| 373903.Hore_00060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]