SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|220930962|ref|YP_002507870.1| from Halothermothrix orenii H 168

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220930962|ref|YP_002507870.1|
Domain Number 1 Region: 5-280
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.04e-114
Family G proteins 0.00000000768
Further Details:      
 
Domain Number 2 Region: 477-598
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 5.31e-46
Family Translational machinery components 0.00000389
Further Details:      
 
Domain Number 3 Region: 263-402
Classification Level Classification E-value
Superfamily Translation proteins 6.82e-37
Family Elongation factors 0.0000335
Further Details:      
 
Domain Number 4 Region: 602-688
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 7.67e-33
Family EF-G/eEF-2 domains III and V 0.0000584
Further Details:      
 
Domain Number 5 Region: 402-479
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 5.4e-25
Family EF-G/eEF-2 domains III and V 0.0000271
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|220930962|ref|YP_002507870.1|
Sequence length 689
Comment translation elongation factor G [Halothermothrix orenii H 168]
Sequence
MARQYPLKKTRNIGIMAHIDAGKTTTTERILYYTGRVHKMGEVHDGAAVMDWMEQEQERG
ITITSAATTCEWQKHRINIIDTPGHVDFTVEVERSLRVLDGAIALFCAVGGVEPQSETVW
RQADKYQVPRIAFVNKMDRMGADFFHVIEMMEDRLGANAVPLQIPIGSEDDFEGIVDLVT
MDAVVYKDDLGVKYERVDIPEDYREQAEEYRENLLEAISELDDEIMMKYLEGEEITTDEL
KTALRKGVLDVEIVPVLCGSAFKNKGVQLLLDAVIDYLPSPVDVPPVEGMNPDTEEEEIR
KAGDDEPFSALAFKIMADPYVGKLTFFRVYSGVLEAGSYVYNSTKGHKERIGRILQMHAN
HREERESVHAGDLAAAVGLKNTATGDTLCDEDHPIVLESMEFPEPVISVAIEPKSQAEQD
KLSLALQRLAEEDPTFKVRTDEETGQTIIRGMGELHLEVIVDRLLREFKVDANIGRPQVA
YRETITRKVTDVEGKFIRQSGGRGQYGHVIIDIEPLEEGEGFEFVNKIVGGAIPKEYIPA
VEDGIVEAMENGVLAGYPAVDLKITLKDGSYHEVDSSEMAFKIAGSIAFKEGAQKASPVI
LEPIMDVEVVVPEEYMGDVIGDLNGRRGNVQGMERRASAQVVKAYVPLAEMFGYATDLRS
KTQGRATYTMQFSHYEPVPDNIAKEIIGK
Download sequence
Identical sequences B8D0C1
373903.Hore_01140 WP_012635074.1.20074 gi|220930962|ref|YP_002507870.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]