SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|220931069|ref|YP_002507977.1| from Halothermothrix orenii H 168

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220931069|ref|YP_002507977.1|
Domain Number 1 Region: 86-177
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 5.46e-33
Family Imidazole glycerol phosphate dehydratase 0.00015
Further Details:      
 
Domain Number 2 Region: 2-83
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.3e-31
Family Imidazole glycerol phosphate dehydratase 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|220931069|ref|YP_002507977.1|
Sequence length 197
Comment imidazoleglycerol-phosphate dehydratase [Halothermothrix orenii H 168]
Sequence
MVEITRKTKETKIKLNLDLDGQGRAKINTGIGFFDHMLELWAVHGFFDLVLSVEGDLEVD
GHHTVEDTGIVLGEGLKKALGNKAGLKRYGNVIIPMDESLVLVSLDLSGRPYYEDDLVFN
RTQVGGFPVELLEEFFRALTNNAGITLHIKMLRGKNTHHLIEACFKGFGRALDVALTGEE
RLNNTPLSSKGSLGEGG
Download sequence
Identical sequences B8D113
gi|220931069|ref|YP_002507977.1| WP_012635180.1.20074 373903.Hore_02210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]