SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|220931186|ref|YP_002508094.1| from Halothermothrix orenii H 168

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220931186|ref|YP_002508094.1|
Domain Number 1 Region: 572-765
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.63e-35
Family ATP-dependent protease Lon (La), catalytic domain 0.00022
Further Details:      
 
Domain Number 2 Region: 34-92,315-565
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000000163
Family RecA protein-like (ATPase-domain) 0.074
Further Details:      
 
Weak hits

Sequence:  gi|220931186|ref|YP_002508094.1|
Domain Number - Region: 56-229
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00157
Family Shikimate kinase (AroK) 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|220931186|ref|YP_002508094.1|
Sequence length 810
Comment peptidase S16 lon domain-containing protein [Halothermothrix orenii H 168]
Sequence
MRDIKNLKPEELKNEIDPDLFSFKTTEEITPFTSGIIGQSRAVKAMDFGLRVKQEGYNIY
MAGITGTGKTTYARTLTRRESKKHPVPPDLCYVFNFEEPEKPRALKLPAGTGIHLKKDMD
NIIEELKVEIPKIFESEEYEEQKNRIMNRYQQLSNQIMEEFEIEVRDKGFILQQTVQGPL
TVPIDEDGNPITQEDYQSLPEDKRKEIREKNQEIQNKMDAIMKKIRGLKTEAQEELENLE
KSMVLSVVKPIINHLKEEYRFCQDILDYLDDVKNDIAKNLGMFKGDNKNKEAKKASLPFT
METGDDDFFVRYKVNLLVNNRDTEGAPVIVETNPTYYNLFGKIEGRSQFGTVTTDFTMIK
GGAIHKANGGYLILKAKDILRNPYAWETLKRTLINQRIVVENIGEQYRTVPVLTLKPEPF
DIKLKVIMIGNPMIYQLLYNHDEEFQKLFKIRAHFDVEMEKNNENIEKFASFIASVSNRE
GIKHFTAGAVAEVISYSSRLAGKKDKLSTRFNQIIEILYEASTWAELDNSSYVEASHVIK
AVEEKERRANLVEEKMQEMIEKEQILLDVTGEKVGQINGLSVIQTGGYSFGRPSRITART
FMGRKGVINIEREAKMSGKIHNKGVLILSGFLGGKYARERPLTLSASLAFEQSYSGVDGD
SATCAELIALLSALTGLPVKQNLAITGSLNQKGMVQPVGGINQKIEGFYKVCEAKGLTGK
QGVIIPEQNTDNLMLKEDVIATVKRGEFHIYSIKEIDEAIELMFGLSAEEVHTKVEESLD
KINEKAREFNREFKEGRKKEELAKIIIKYY
Download sequence
Identical sequences B8D1M2
WP_012635287.1.20074 373903.Hore_03380 gi|220931186|ref|YP_002508094.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]