SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|220931645|ref|YP_002508553.1| from Halothermothrix orenii H 168

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220931645|ref|YP_002508553.1|
Domain Number 1 Region: 164-281
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 4.56e-32
Family Homoserine kinase 0.0021
Further Details:      
 
Domain Number 2 Region: 1-154
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.11e-26
Family GHMP Kinase, N-terminal domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|220931645|ref|YP_002508553.1|
Sequence length 311
Comment homoserine kinase [Halothermothrix orenii H 168]
Sequence
MFTIKIPATSANLGPGFDSLGLSLQLYNKFTFKRLKSSDIRIKIKEVDTGNIIELPIKDN
LIYRAMMYLFERYDVRPEGIELMEEVAIPFARGLGSSATAILGGLFGANIMLGEPLEDEE
LLKIAVKLEKHPDNVVPALKGGFVINVLKGSDLYYKKINPGEQLRVILCIPEFQLKTEDL
RQVLPRQIEFKDAVFNHSRTAFLTSCFYERDWESLRVAMQDRLHQDYRSSLIPGFDEVVK
SAYDNGAVGVALSGAGPTVISFAKDKGDKIGEAMVKAFGHYNINSKYIETGLDNKGLILK
GHKFSLSGGSR
Download sequence
Identical sequences B8CW89
373903.Hore_08010 WP_012635746.1.20074 gi|220931645|ref|YP_002508553.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]