SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|220931816|ref|YP_002508724.1| from Halothermothrix orenii H 168

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220931816|ref|YP_002508724.1|
Domain Number 1 Region: 5-275
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.37e-80
Family G proteins 0.0000059
Further Details:      
 
Domain Number 2 Region: 471-591
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 9.1e-47
Family Translational machinery components 0.00000838
Further Details:      
 
Domain Number 3 Region: 592-684
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 9.78e-30
Family EF-G/eEF-2 domains III and V 0.00011
Further Details:      
 
Domain Number 4 Region: 259-393
Classification Level Classification E-value
Superfamily Translation proteins 6.13e-26
Family Elongation factors 0.0011
Further Details:      
 
Domain Number 5 Region: 396-473
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 2.45e-16
Family EF-G/eEF-2 domains III and V 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|220931816|ref|YP_002508724.1|
Sequence length 688
Comment translation elongation factor G [Halothermothrix orenii H 168]
Sequence
MASVKTDKIRNLCLISHGGAGKTTITEMSLYNSGVIKEPGRVEDGTTHSDYMPEEKKHQF
SVVNSFFSIPWNGNQINWVDTPGYADFRGEVSSALKIVDAAVLIINGNSGIEVNTNYVWT
MAEDNNVARFVFINKMDKDGAKFDKVFEEIQNNLNGHFVPLTIPYGEGENYKGIIDLLKK
EALLYGDDGESKSDIPDGLADRVEELWTELLESVVELDDELMMKYFDDEEITDKEMIKGL
INGVRAGDIIPVMVGSAINNSGIKTLLNYLSSLVPAPTDIGTVTGTWEGEEIKIEAGESG
PFVGQIGKTMVDPYIGKLSIFRVLSGKLNTGSEIFVPRLNNTIKASKLYKLNGEEQETVD
ELKAGDIGAIAKIDDLETSDTLSDPDFKVELDPIIFPEPMLTKTALPASEGDDEKMSTVL
HRISQEDPTFKVEYNKVTKELLVTGMGTVHLDVIKDICKRKFGVEFVTGIPKVAYKETIQ
SRVEVEEKYKKQSGGRGQYGHVFLRIEPLPRGKGFEFDEEIFGGAIPSQYIPAVEKGVVE
AMEEGVMAGYPVVDCKVTVYDGSYHSVDSSEMAFKIAASKAFKKGMEQAKPVLLEPIMDV
EVIVPEEYMGDIMGDLNSRRGKIQGMSSRDGLQVIKAHVPQAEMFTYATDLKSLTGGHGK
FTMKFAYYDKVPKKIEDEIIKERNTETA
Download sequence
Identical sequences B8CWR0
373903.Hore_09730 gi|220931816|ref|YP_002508724.1| WP_012635915.1.20074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]