SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|220931882|ref|YP_002508790.1| from Halothermothrix orenii H 168

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220931882|ref|YP_002508790.1|
Domain Number 1 Region: 1-220
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.5e-46
Family Nucleotide and nucleoside kinases 0.00000906
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|220931882|ref|YP_002508790.1|
Sequence length 228
Comment cytidylate kinase [Halothermothrix orenii H 168]
Sequence
MNNVIAIDGPAGAGKSTLARLLARKLKYRYLDTGAMYRAVTWLALRENIDLDNIQGLTSL
ANNIDIEFSPPSGDRKGRIYVNGNDVTEEIRTPLINKNVSKVARVKGVRDAMVRQQRKLA
QGGHIIIDGRDIGTRVVPDAEFKFFITASLEERARRRYTELKEKGTGVNFQEVKAEIARR
DKIDSERECSPLTKPEDAFLIDTTGMSIDEVLTRVINIIRTGGQDLNE
Download sequence
Identical sequences B8CWX6
373903.Hore_10390 WP_012635980.1.20074 gi|220931882|ref|YP_002508790.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]