SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|220932003|ref|YP_002508911.1| from Halothermothrix orenii H 168

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220932003|ref|YP_002508911.1|
Domain Number 1 Region: 2-215
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 2.62e-54
Family DNA gyrase/MutL, N-terminal domain 0.00000454
Further Details:      
 
Domain Number 2 Region: 454-642
Classification Level Classification E-value
Superfamily DNA mismatch repair protein MutL 2.75e-51
Family DNA mismatch repair protein MutL 0.005
Further Details:      
 
Domain Number 3 Region: 190-323
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.55e-35
Family DNA gyrase/MutL, second domain 0.00074
Further Details:      
 
Weak hits

Sequence:  gi|220932003|ref|YP_002508911.1|
Domain Number - Region: 403-473
Classification Level Classification E-value
Superfamily Peptidoglycan deacetylase N-terminal noncatalytic region 0.0366
Family Peptidoglycan deacetylase N-terminal noncatalytic region 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|220932003|ref|YP_002508911.1|
Sequence length 644
Comment DNA mismatch repair protein MutL [Halothermothrix orenii H 168]
Sequence
MPEIKRLPESVANQISAGEVVERPASVVKELVENSLDAGSNKILIEIENGGKDLIRVKDN
GHGIPSDEIEIAFDRYATSKITDINDLYSLKSLGFRGEALASIASVSILDIISRTKSQTK
AIKMRLKGGKVISKEPCGASVGTDIIVKDLFFNTPARYKYLKTTRNEFKHISNIITREAL
AYPGVNFTLIHNGRIVLKTPGTGKTLDCIYAIYGKEMAQSLVKIDYEDRYIKVSGYISRP
DYYRYNRSYEIFFVNKRAVHNSILNRGVEEAYQGLLPPGAYPVVFLNLKLNPILVDVNVH
PTKKEVKFSRDKVIKEVIQNGINIELSKLDKSPRLKRNINPLNRDDKTKDKSEYQKIKLP
EDKEQITNKSSDAGILKNQNPLDSQDSILLPSKKNGFYSKKNSQVSQNKFMDINNKLEKT
EINDNYKKDKHYKTDSINIKDNSIKENKNKMDIPIKRVLGQIKNTYIIAEGRDGLYIIDQ
HNAHERILYQSFIEKYNNSEIVSQPLVVPVNIETTAPEAEVLKSYLPQLEKMGFKLEVFG
INSFIVREVPSLIKKRSNKRVVREVIDKLLEHDKAMKPSELINEIISYMSCRGAIKAGEY
LDKKEAEQIIEGLFKTDNPYRCPHGRPIIIHITEDDINKGMGRK
Download sequence
Identical sequences B8CX97
gi|220932003|ref|YP_002508911.1| 373903.Hore_11660 WP_012636101.1.20074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]