SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|220932327|ref|YP_002509235.1| from Halothermothrix orenii H 168

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220932327|ref|YP_002509235.1|
Domain Number 1 Region: 600-775
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.93e-54
Family ATP-dependent protease Lon (La), catalytic domain 0.00000162
Further Details:      
 
Domain Number 2 Region: 315-595
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.41e-51
Family Extended AAA-ATPase domain 0.0021
Further Details:      
 
Domain Number 3 Region: 15-207
Classification Level Classification E-value
Superfamily PUA domain-like 3.23e-44
Family LON domain-like 0.0000972
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|220932327|ref|YP_002509235.1|
Sequence length 783
Comment ATP-dependent protease La [Halothermothrix orenii H 168]
Sequence
MDQEMVTKETEKYIELPLLASRGVVVFPHMVIPLLVGREKSIEALEKAMVKDKEIIILSQ
KDEKIEDPDPEDLYTIGTIAEVKQLVKLPNGMLKVVVEGIKRARIIDFIEIDEYFEVRAE
ILDQTVPEVDLEMKALMKAVLNKFQEYIKYNRNLPSETIMTVTNIEEPARFSDTIASHLE
LKFRQEQDLLEAISIKERLNKLLEIIKDEIEILKVEQKIQKKVRKQVEKTQKEYYLREQL
KAIKEELDEDEEDDEIEEYRNKAEELDLPEKIREKVDKEIEKLKKTPSMSPEATVIRNYL
DCVLDLPWNKVREEKIDLDEAKNVLDSEHYGLEDVKERILEYLAVRKLAPQKKSPILCLI
GAPGVGKTSLGRSIARALGRDFVRLSLGGVRDEAEIRGHRRTYIGSRPGRIINAMREAGS
KNPVFLLDEVDKMSSDFRGDPAAALLEVLDPEQNNEFTDHYLELPFDLSKVLFVTTANVA
YPIPAPLLDRMEVIELPGYTEDEKVEIALRHLIPRILNEHGLTEDEIHFSSNSIYRIIRE
YTREAGVRNLERKLAAITRKVSKEIVEGRGRQARVTTQSIEKYLGVPKFKYEKAQKKDRV
GVATGMAYTQTGGDILDIEVAVVPGKGKLTLTGSLGDVMKESARAALSYIRSKQEELGLS
DNFHEEYDLHVHVPKGATPKDGPSAGITIASAIASALTGQPVKGKYAMTGEVTLRGRVLP
VGGIKTKIMAARRAGLKDIIMPEENKKDFEEIPVKIKKDIRVNFVNHMDQVLDLILGGDE
DEN
Download sequence
Identical sequences B8CY71
373903.Hore_14910 gi|220932327|ref|YP_002509235.1| WP_012636423.1.20074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]