SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|220932376|ref|YP_002509284.1| from Halothermothrix orenii H 168

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220932376|ref|YP_002509284.1|
Domain Number 1 Region: 172-271
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 0.000000116
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.031
Further Details:      
 
Weak hits

Sequence:  gi|220932376|ref|YP_002509284.1|
Domain Number - Region: 34-79
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00115
Family YjeE-like 0.066
Further Details:      
 
Domain Number - Region: 33-158
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00778
Family YjeE-like 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|220932376|ref|YP_002509284.1|
Sequence length 298
Comment hypothetical protein Hore_15400 [Halothermothrix orenii H 168]
Sequence
MIDSFAHSVFFAPRGKERLLQLGNRISQSYMHPNDKLIGLIGDAGAGKSLLIKGMFPGLT
LTNDDEGINIRPLPVYNDYQEGKFTSHTYHVDIRFETAFTQPWQLAEAIEKAIEKDRRVV
VEHYDLIESHLNINPEMLVGIGEEVIVTRPGVFGPFSKEIAKIVFNSIKYRRMAHTAEDL
TAMAIEKRGYTRTPYHSDVKSGFVLQFDEKPDFSIKDVENEVKEYIDRDLRVRYRDDNHI
KIGDKEYSCTGPRIHVRRTGEIEGFKLMDFKYDPATGFYLMAGLVGDDEHSQFQLTKL
Download sequence
Identical sequences B8CYC0
gi|220932376|ref|YP_002509284.1| WP_012636472.1.20074 373903.Hore_15400

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]